SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000418385 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000418385
Domain Number 1 Region: 723-890
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.82e-35
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.045
Further Details:      
 
Domain Number 2 Region: 585-669
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000131
Family WWE domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000418385
Sequence length 901
Comment ZC3HAV1 (Homo_sapiens) zinc finger CCCH-type, antiviral 1
Sequence
MADPTVCCFVTKILCAHGGRLSLDALLEKIELSEAQLLEVLKEAGPDRFVVLETGGRAGV
TRSVVATTRARVCRRKFCERSSCDNLHLCKLNLLGRGHYSQSERNLCKYSHDVLSEKNFQ
VLKNHELSGLNQEQLAVLLLQSDPFFMPEICKSYKGEGRKQICNQQPPCERLHICEHFTR
GNCSYPNCLRSHNLMDRKVLAIMRDHGLSPAVVQNIQDICNNKHMRRNPPGSKTPVHRRA
RAARGRSKSRDRVSQDIKEFLPSASAHKSGTPSPDGTDSRASLEDDPMDDLIHKFEFLET
PDCTQPSSVSSKAAGLGRPGQVGTSQRFLENGIPDGLFHSNQSHLASNSTPASNQKGSPS
WLNAQGTGKESEFFPSQAVPSFPLDSTQTLKALNSRKVVGMLSSDHMNVKDKSGSQDIQR
IPIFSRNADGVAMNMNFGKTAQREMALSSYQDSRATPRDLHIGSIASDDARVAFLNDSIS
DITNTTSRMGNLGPEGICVDYLHNRCQPNSDCSKIHFPLPYRWQVLMSHTWKDLEDMEKI
EKAYCNPRSHVLSIENHILDFQKMTYALKPIRRISSPSSGMNQASTVFTTKWIWYWENES
GEWIQYGKGSNNQPGSNIDSSYLESFFQKCPRGVVPFQAGTRNYELSFQGMIQTNIASKT
QKNVVRRPEFVSARDVEQMRRGPDPQRVQFSASSPQPVHTPPEAVGSTFVPQWDVLSPTS
SGYKLLDLDNQSLEYATIRDNFKESMKNFKIEKIKKIHNPELLNSFERRRLNMTEKRERL
LFYATSRTHVDSICANNFMWNLHGTHENKYGKGNHFSKDAIYSHKNCLYDARNIVMFVAR
VLAGDFIEGNMTFVSPPPPYNSCVDTMLNPSVFVIFRNDQVYPAYLIEYSEPDREKACVI
S
Download sequence
Identical sequences G5B553
HGL_H00000418385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]