SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000418744-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000418744-1
Domain Number 1 Region: 88-120,151-208
Classification Level Classification E-value
Superfamily SH3-domain 8.66e-18
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 2 Region: 19-101
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000000000023
Family BAR domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000418744-1
Sequence length 209
Comment SH3GLB1 (Homo_sapiens) SH3-domain GRB2-like endophilin B1
Sequence
MNIMDFNVKKLAADTGTFLSRTMQNFIEGDYKTIAKERKLLQNKRLDLDAAKNRLKKAKA
AETRSSSEQELRITQKAQMTYYAQCYQYMLDFQKQLGSFPSNYLSNNNQTSRTPMPSTLS
NAVGSSAMASTSGLRITSPSNVTDLKESSGSRKAKVLYDCDATNSTELSLLADEVITVFS
VPGMDSDWLMGERENQKGKVPINYLELLN
Download sequence
Identical sequences G5B157
HGL_H00000418744-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]