SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000418748 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000418748
Domain Number 1 Region: 465-552
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.39e-16
Family Canonical RBD 0.0016
Further Details:      
 
Domain Number 2 Region: 286-376
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000652
Family Canonical RBD 0.00072
Further Details:      
 
Domain Number 3 Region: 389-462
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000117
Family Canonical RBD 0.0039
Further Details:      
 
Domain Number 4 Region: 105-237
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000622
Family DnaQ-like 3'-5' exonuclease 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000418748
Sequence length 719
Comment ESRP2 (Homo_sapiens) epithelial splicing regulatory protein 2
Sequence
MRNYADEDLFPPRVSLAGPDVAPFSECAKCDFSLDSGRVWQSHVRFRRAGDPFSRRITSF
SVTLQLSGVWGRGGSSVPPFPNVTLAHCNRALSCGHFTRPVWQVVEPRSRQVGTLHKSLV
RAEAAALSPQCREASGLSADSLARAESLDKVLQQFSQLVNRDVALLGGGPYVLCTDGQQL
LRQVLHPEASRKNLVLPDTFFSFYDLRREFHMQHPSTCSARDLTVATMAQDLGLETDATE
DDFGVWEVKTMVAVILHLLEGPSGQLFSKPEVVKQKYETGPCSKADVVESETVVRARGLP
WQSSDQDVARFFKGLNIARGGVALCLNAQGRRNGEALIRFTDREQRDLALQRHKHHMGVR
YIEVYKATGEEFVKIAGGTSLEVARFLSREDQVILRLRGLPFSAGPADVLSFLGPECPVT
GGADGLLFVRHPDGRPTGDAFALFACEELAQAALRRHKGMLAGTGRDCVRLRGLPYTATI
EDILSFLGEAAADIRPHGVHMVLNQQGRPSGDAFIQMTSAERALAAAQRCHKKMMKERYV
EVVSCSTEDMSRVLMGGTLSRSGMSPPPCKLPCLSPPTYATFQATPTLIPTETAALYPTS
ALLPTARVPAAPTPVAYYPGPATQLYMNYTAYYPSPPVSPTTVGYLATPPTALGSTSTSM
LSQPGALIRMQGVPYTAGMKDLLSVFQAYQLAPDDYTTLMPVGDPPRPVLQAPKEWVCL
Download sequence
Identical sequences G5C688
HGL_H00000418748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]