SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000419135-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000419135-1
Domain Number 1 Region: 80-139
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 332-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 490-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 557-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000842
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 5 Region: 423-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000265
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 389-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000844
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 7 Region: 296-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000358
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000419135-1
Sequence length 621
Comment ZNF655 (Homo_sapiens) zinc finger protein 655
Sequence
MEELSAQEATGSPRVQFQSLETQSECLSPEPQFMQDTDMEQGLTRAPPVPQVPALPHQGS
PGDQAAAPLTARYQSSQDVLFQEFVTFEDVAVYLTREEWGRLDPVQRDLYREVMLENYGN
VVSLGFPISTPDGISQLEQDLQVFDLETKNREVLRGDSSDGETREENKLLIPKQKNLEEV
HSYKVRVGRLKQDISQVPETREVHESEDRLERLQEILRKFLFLEREFRQITISKKTITSE
NNECNEPEKSFSLDSALDTDHRVLRIQNIDDNKYDMNFTQNSAADKHEHINLQQTFQNSE
YKESLMDLSHFSKWESISATEKSYKCDTCGKVFHQSSALTRHQRIHTREKPYKCKECEKS
FSQSSSLSRHKRIHTREKPYKCEASDKSCEKSDKSCSQSSDVIQHKKIHTKAKSYKCNNC
ERVFSRSVHLTQHQRIHREMPCKCTVCCSDFCHTSYLVEHQRVHHQEKSYECDECGLAYV
KHQGIRFREKPYTCIECGKDFRLNSHLIQHQRIHTGEKPHECNECGKAFSQTSCLIQHHK
MHRKEKSYECNDHEESFSHSSDLLQQEVLTREKVFDCHAWEKNFSQRAHLVQHQTIHTKE
KPYECSEHGKTFSQVQSSFNI
Download sequence
Identical sequences G5AX97
HGL_H00000419135-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]