SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000419199 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000419199
Domain Number 1 Region: 10-149
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.17e-20
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 224-276
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000144
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000419199
Sequence length 277
Comment ASB14 (Homo_sapiens) ankyrin repeat and SOCS box-containing 14
Sequence
MLVPVTDLAAIKWSGINPVHCAAAGAHTQCLELLIQAGFDVNFMLDQRIHKHYDDQRKSA
LYFAVSNGDLSSVKLLLNAGVLPNQDPVNCLQIALRMGNYELISLLLRHGANVNYFCRVN
PLHFPSALQYTLKDEVMLRMLLNYGYDTERCFDCPHGDKVRLYAFEGWTSTVIKDTMFCE
VITLSWLRHLSGKVVTVMPDYVDQVRICSKLKSVLQNQGLWSEIHFILTNPRSLKHLCRL
KIRKCMGRLRLRCPVFMSFLPLPNRLKAYILYKEYDL
Download sequence
Identical sequences G5ATN3
HGL_H00000419199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]