SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000419242 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000419242
Domain Number 1 Region: 61-141
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000186
Family Canonical RBD 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000419242
Sequence length 382
Comment C7orf64 (Homo_sapiens) UPF0712 protein C7orf64
Sequence
MLGYKADVVLPVSSKAANMASYDGKLGSLFDHHVQKEVCDTRAKYREGRRARAVKVYTIN
LESRYLLIQGVPAVGAMKELVERFALYGTIEEYNALDEYPAEDFTEVYLIKFMNLQSSRI
AKKKMDEQSFFGGLLHVCYAPEFETVEETRKKLEERRAYIARTTKNKDYYMTKKKPVPEN
KDTEDFRQAFHSNMSVFHAATLNTSTGNSNTYSSELPICYFASKCACSPGEHVDRASSSY
KDGRNHNKTVKRCIHSDSSPKLQMNTLKNSVPCSGAQKAITPSGAIDRFMPRTTQLQERK
RRREDDRKLGTFLDTSTGSNEVMIGPKLPDIAKVDLQDDSLNTTANLIRNKLKEVSSSVP
KPPEDKLEAEHMSHPLKQRRRI
Download sequence
Identical sequences G5C9J7
HGL_H00000419242 XP_004862424.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]