SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000419313 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000419313
Domain Number 1 Region: 13-154
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000606
Family Ankyrin repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000419313
Sequence length 649
Comment TRPC1 (Homo_sapiens) transient receptor potential cation channel, subfamily C, member 1
Sequence
MALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAITIT
IENENLDILQLLLDYGCQSADALLVAIDSEVVGAVDILLNHRAKRSSRPTIVKLMERIQN
PEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSR
FRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKD
LLAQARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFL
NTVWFGQMSGYRRKPTCKKIMTVLTVGVFWPVLSLCYLIAPKSQLGRIIHTPFMKFIIHG
ASYFTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFL
EESRNQLSFVMNSLYLATFALKVVAHNKISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLY
DKGYTPKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQS
FVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIAEWRNLKQKRDENYQKVMCCLVHRYLT
SMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPRN
Download sequence
Identical sequences G5ALG9
HGL_H00000419313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]