SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000419446-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000419446-2
Domain Number 1 Region: 370-563
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.07e-62
Family Reprolysin-like 0.00013
Further Details:      
 
Domain Number 2 Region: 582-658
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.7e-19
Family Blood coagulation inhibitor (disintegrin) 0.00021
Further Details:      
 
Domain Number 3 Region: 15-128
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000179
Family Canonical RBD 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000419446-2
Sequence length 941
Comment ADAM9 (Homo_sapiens) ADAM metallopeptidase domain 9
Sequence
MELLMGLESQGDMLEESMKKAADVLNKHSVSGRPLKVKENPDSEQSRRAMQKAGRLGSTV
FVANLDYKVGWKKLKYLVMAGMMVQADILKDKDGKTRGIGTVTFEQSIEAVQAIFMFNSQ
LLFDRLMHEKALPKGNFFFSLLNIHSNFAMDLMAWGLAWSTRSSDGWITWPNSLEWMGAN
NLKVMGPTLGTGIEPRGLAMVGSGGANFDRTKMEMETLEEASQVSYVIQAQGKEHIIHLE
RNTDLLPKDFVVYTYNKEGALISDHPNIQNHCHYRGYVEGVYSSAVALSDCFGLRGLLHL
ENASYGIEPLHNSSRFEHIFYRMDDVHNKEPLKCGVSNMDIEKETRKWGEEEHRSMTQLL
RRRRAILPQTRYVELFIVVDKEQYEMMGRNQTAVREEMIHLANYLDSMYIMLNIRVVLVG
LEIWTNRNLIIIAGGAGDVLGNFVQWREKFLITRRRHDSAQLVLKKGFGGTAGMAFVGTV
CSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDGRDCVCGAKSCIMNSGASGSRN
FSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYSAPSCGNKLVDPGEECDCGTPKECELDPC
CEGSTCKLKSFAECAYGDCCKDCQFLPGGSLCRGKTNECDVPEYCNGSSQFCQPDVFIQN
GYPCQNNKAYCYNGMCQYYDAQCQVIFGSKAKAAPRDCFIEVNSKGDRFGNCGFSGNEYK
KCATGNALCGKLQCENVQEMPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGT
KCDVGKICRNFQCVNASVLNYDCDVQEKCHGHGVEKSTTLRDGLLVFFFLVVPLIVLATF
LFIKRDELRKMYFRKKRSQMSDGKNQASVSRQSVNAPRQPMGAPGQPVGAPRQLVSAPRQ
PVGAPQQPAVHANQFPVPVYAAKQPQQFPSRSEVNLIRLPD
Download sequence
Identical sequences G5B0B7
HGL_H00000419446-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]