SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000420193 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000420193
Domain Number 1 Region: 14-152
Classification Level Classification E-value
Superfamily Macro domain-like 5.72e-38
Family Macro domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000420193
Sequence length 153
Comment C6orf130 (Homo_sapiens) Uncharacterized protein C6orf130
Sequence
MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLS
QQKKPGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKCHCLKNGVTDLSMPRQ
IGCGLDRLQWENVSAIIEEIFEATDIKITVYTL
Download sequence
Identical sequences G5BNG9
HGL_H00000420193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]