SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000420195-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000420195-2
Domain Number 1 Region: 21-102
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000489
Family Canonical RBD 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000420195-2
Sequence length 262
Comment SRSF10 (Homo_sapiens) serine/arginine-rich splicing factor 10
Sequence
SRYPGPRPQHVSVRQAVADDTRSEDSRREFGSCGPTVDVYVPLDFYIRRPRGFAYVQFED
VCDAEDVLHNLDRKWICGHQTEIQFAQGDRKTPNQMKPKERRNAYSSLCYNDYDRYRCSR
SRSYERRSRSRALDYICRRSYSPRNITPTGRPRRSRSHSNNDRFKHQNRSFSRSKSNSRS
WSKSQPKKDIKAKSHSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSSQSR
SQSRSRSKSRSRSWTSPKSSGH
Download sequence
Identical sequences G5BTZ6
HGL_H00000420195-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]