SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000420195-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000420195-3
Domain Number 1 Region: 16-96
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.57e-24
Family Canonical RBD 0.00000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000420195-3
Sequence length 123
Comment SRSF10 (Homo_sapiens) serine/arginine-rich splicing factor 10
Sequence
MQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYV
VYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTD
PPK
Download sequence
Identical sequences A0A061I1C9 A0A087QRM1 A0A1V4JN86 G5C384
XP_009272145.1.47732 XP_010391560.2.2935 XP_017944459.1.51550 HGL_H00000420195-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]