SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000420612 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000420612
Domain Number 1 Region: 284-468
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.06e-42
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 149-226
Classification Level Classification E-value
Superfamily WWE domain 0.000000000000275
Family WWE domain 0.0058
Further Details:      
 
Weak hits

Sequence:  HGL_H00000420612
Domain Number - Region: 57-80
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0141
Family CCCH zinc finger 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000420612
Sequence length 476
Comment TIPARP (Homo_sapiens) TCDD-inducible poly(ADP-ribose) polymerase
Sequence
MDYVPGVFQDNSFIIQYILDTSDKLSTELFQDKSEEASLDLMLELVNQLQYHTHQENGIE
ICMDFLQGTCIYGRDCLKDHMVLLYHWQSKRTTTQKWESVSNDSQEHLKRFYCNAENNRM
RVKYGGQEFWADLNAMNVFETTEFDQLQRLSTPPPSNVNSIYHTVWKFFCREHFGWREYP
QSVIRLIEEANSRGLTEVRFIIWNNHYILHNSFFSREIKRRPFFRSCFILLPYLQTLGGV
LTQAPPPLEATTSSQIICPDGVTSANFYPETWVYTHPSQDFFQVPVSAEDKSYQIIYNLF
HKTVPEFKYRILQTLRVQNQFLWEKYKRKKEYMNRKMFGHDRIINERHLFHGTSQDVVDG
ICKHNSDPQVCGKHVTMFGQGSYFAKKASYSHNFSKKPSKGVHFMFLAKVLTGRYTVGSH
GKRRPPPVNPGSVTSDLYDSCVDNFFEPQTFVIFNDDQSYPYFVIQYEEVIKTISI
Download sequence
Identical sequences G5B0N8
HGL_H00000420612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]