SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_M00000049206 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_M00000049206
Domain Number 1 Region: 143-242
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000777
Family Voltage-gated potassium channels 0.036
Further Details:      
 
Domain Number 2 Region: 28-62
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000103
Family Flavin-binding PAS domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_M00000049206
Sequence length 245
Comment Kcnh8 (Mus_musculus) potassium voltage-gated channel, subfamily H (eag-related), member 8 Gene
Sequence
MFLHEEHASEHQVLLLQLIGNTCQSDKTREAGTPVWFYMQIAPIRNEHEKVVLFLCTFKD
ITLFKQPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTEVAHKHSRLAEVLQLGSD
ILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQNNIAWLVL
DSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFE
NVDEE
Download sequence
Identical sequences G5BCY8
HGL_M00000049206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]