SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_M00000054631 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_M00000054631
Domain Number 1 Region: 2-38
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000209
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_M00000054631
Sequence length 75
Comment Gm9222 (Mus_musculus) predicted gene 9222 Gene
Sequence
MEEWALLDPSQKKLHRDVMWETFTNVTAIGRNWENQQQIEDEYQNYRKTLSCHPCVQIQD
SPFLAMWAMLGAIIL
Download sequence
Identical sequences G5C4A2
HGL_M00000054631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]