SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_M00000094921-15 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_M00000094921-15
Domain Number 1 Region: 11-95
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 3.53e-31
Family Retrovirus capsid protein, N-terminal core domain 0.00018
Further Details:      
 
Weak hits

Sequence:  HGL_M00000094921-15
Domain Number - Region: 94-122
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0228
Family Ribonuclease H 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_M00000094921-15
Sequence length 222
Comment BC040756 (Mus_musculus) BC040756 protein Fragment
Sequence
GPPLALQETEQGHYVYIPFTTSDLYNWKHQNPPFSEKPQALISLLESIFHTHGLTWDDCQ
QLLQALFTSEERKRIRGQAVRLVLEVVNQDQQVEWEQGLPQGTSAQKAELIALTKALELV
HQLQSELHDKLRKTMPGPSEKPLQPLPYKPRDLVFIHRFDSKTLEPCWKGPFPIVLVSPS
AVKVAGHSAWIHHSHLKVAPPEEAMSTWRIDQNKEDPLKIRL
Download sequence
Identical sequences G5BI31
HGL_M00000094921-15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]