SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_M00000094921-28 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_M00000094921-28
Domain Number 1 Region: 18-144
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 6.04e-46
Family Retrovirus capsid protein, N-terminal core domain 0.0000195
Further Details:      
 
Weak hits

Sequence:  HGL_M00000094921-28
Domain Number - Region: 154-175
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0366
Family Retrovirus capsid protein C-terminal domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_M00000094921-28
Sequence length 234
Comment BC040756 (Mus_musculus) BC040756 protein Fragment
Sequence
GPADSTVLPLRAAGPPDEQGNQPHHYWPFATSDLYNWRTQHANFSDNPRDVINLLETVLF
THQPTWDDCQQLLQILFTTEECERIQNEARKLVPGDNDQPTTNIDTINTSFPLSWPNWDF
NRAEGKERLQVYRQALLGGLEEAACKPTNLAKVGDIQQGPNESPAAFLERIQEAFCSLDR
LLSPTALKVDGVATWVHYTHVRPADPSAVSEDFIPTWQVPRNEDNPLELKFKRT
Download sequence
Identical sequences G5CA87
HGL_M00000094921-28

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]