SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_M00000102130 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_M00000102130
Domain Number 1 Region: 246-393
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.61e-24
Family DnaQ-like 3'-5' exonuclease 0.0016
Further Details:      
 
Domain Number 2 Region: 518-691
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000412
Family Canonical RBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_M00000102130
Sequence length 776
Comment 2610020H08Rik (Mus_musculus) RIKEN cDNA 2610020H08 gene Gene
Sequence
MRLWRPRAETDPFMETEKEKTGEHPRKDRKRRQVSNQLVRATEPRRACWALKDLRPEAKK
ARLSAILFACNCQVTPGQLCELLKYAVLGRSIVPRPSWCQIFHQNHPNNVVVFILQGMSQ
LHFYKFYLEFELLWKIFRHKFCLPPQSSNFLADIIGLQKKTTGDLPKTSKGSLPSSSSKA
NINLHNDSIIQKHGSKKVGLSCCLLTMEEMKTFHFPLQGSPDCENFIPTKCNGSITDNSP
LFGLACEMCLTSKGRELTRISLVAEGGCCIMDELVKPDIRIVDYHTSFSGITKTIFNSVA
TKLKDVQRQLSALLPPDAVLVGHSLDLDLRALKMIHPYLIDTSLLYVREQGRRFKLKFLA
KAILGKDIQHPNTLQHDATEDARTALELAQYFLKYGPKKIAELNLESLGSHQELQAAGQK
PRNTTEIPHPNTSVLECVNLVGQKLLFVALEKGATELSSYGNCETIKCLSNKEVSDLLSL
SRPEWKFFPFSIVQFSFDPFTPVFTEEMSKRMKTKWREMSTVYAGPVSRTYNFRPLKRLL
KSFGPIQSMSFVLETYQLESNKEEILIFLQPHLCVQYEVLEAAQLAIESLNGIVVEGICI
KVQRPVTELTLDCDILMKELERDSENRDTIYLSGVSESFKDHIFHVSSHFPGLEAVILPK
DLESGKQKKFCFMKFKTFASAQRALNILTGKDWKLKGRGALTPRHLHKWLRGFSPESRWP
PGLRVMPPPSEQQALQTLKTDHPKVAAWYWGQKIGKLYQNMNPGTLCLILLPGCKR
Download sequence
Identical sequences G5BV98
HGL_M00000102130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]