SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_M00000103967 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_M00000103967
Domain Number 1 Region: 3-58
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.99e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_M00000103967
Sequence length 124
Comment Prkcz2 (Mus_musculus) protein kinase C, zeta 2 Gene
Sequence
MLYYANGHTFKAKHFSRRAHCAVCPDRVGGLGRQVYKCTNCKLSVHKKCHNLVTIECRQR
SLPSEPMVPVDPSSMASDPAHTVMPHNLSTHWALEQVDEENKAGNTGEGAKASSGLGLED
FDLL
Download sequence
Identical sequences HGL_M00000103967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]