SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_N10001994 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10001994
Domain Number 1 Region: 16-120
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-22
Family SH3-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_N10001994
Sequence length 149
Sequence
MWTEHVLILSPKLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQID
DEEGWFPASFVRLWVNQEDGVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEI
MSTERHYIKHLKDICEVDIMVHVVAHRVG
Download sequence
Identical sequences G5BHS2
HGL_N10001994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]