SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_N10002761 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10002761
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily ALDH-like 2.49e-26
Family ALDH-like 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_N10002761
Sequence length 98
Sequence
MHGGEIDKEQYDKILDLIESGKKQGAKLELGGGPWGNKGYFIQPTVFSNVTDEMRIAKEE
IFGPVQQIMKFKTLDEVIRANNNTTYEQESLPKTLTKQ
Download sequence
Identical sequences G5BLW5
HGL_N10002761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]