SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_N10003768 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10003768
Domain Number 1 Region: 27-68
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000395
Family Eukaryotic type KH-domain (KH-domain type I) 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_N10003768
Sequence length 68
Sequence
MYNDTLNGSTEKRSAELPDTVGPIVQLQEKLYVPVKEYSDFNFVGRILGPRGLTAKQLKA
ETGCKIMV
Download sequence
Identical sequences G5B5T0
HGL_N10003768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]