SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_N10004520 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10004520
Domain Number 1 Region: 235-361
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.21e-20
Family Canonical RBD 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_N10004520
Sequence length 383
Sequence
MDSRVTVVMASQQILQAMAKAATVPLMDRLRTQAMALSQLPRVMAPLVAMAVARVPSHHM
GSSPLTLAMASGQLPAAPPEVMVAVLRAAAMGSPKVGVMDNSLAMVDSNRAMGSSKAPII
PLRTMDNRTNTTVAVEVVEGVWRQLWPRSSSKSGGGGGYGHQDQSGGGSGGYRGGQQDRG
GRGEGGSIGYNRSSGGYEPRGRGGSRGGGGGMAGSDRGGFNKFGGPRDQGSRHDSEQGNS
DNNTIFVQGLGENVTIESVADHFKQIGIIKTNKKTEQSMINLYTDRETAKLKGEGTVSFD
EPPSAKAAIDWLEGKEFSGNPIKVSFATRLADFNQDGGNGRGGRGRGGPTGHGGCGGGGS
GGGGLGGFPSGGGGGGGQQRAGD
Download sequence
Identical sequences G5B3E8
HGL_N10004520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]