SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_N10005061 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10005061
Domain Number 1 Region: 66-119
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000299
Family Canonical RBD 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_N10005061
Sequence length 120
Sequence
MVAGVKVAAEVATTEPKMEEESGIPSLPRSNGAPGLKEILSNALKRGKITAMQGRGGGGG
SSHGIKRMMLKDKFKECGHVLHANIKMENGKCKGYGVVELPKLAERACQIMSGMKLSGRD
Download sequence
Identical sequences G5BLC7
HGL_N10005061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]