SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_N10005278 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10005278
Domain Number 1 Region: 20-116
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000925
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_N10005278
Sequence length 118
Sequence
MDKAAHPIHQNHVWEDVTLHNSSLPPLAIKNPKCLGLLHQLDRGPDVWVQHYCVLKDGCL
YFYFSIRSTQASGGLYLQGYKVSEQIHSFKQSATELEPPSEEFKTFYFCAENRTENQW
Download sequence
Identical sequences G5B9D2
HGL_N10005278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]