SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_N10005559 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_N10005559
Domain Number - Region: 3-68
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00364
Family Canonical RBD 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_N10005559
Sequence length 144
Sequence
MDEYKTLLLSSLSPALPPEHLEGRLFHQFKRLGEITLLLWHTPELELGRMAYVNLRHPQD
AHEAHQLLLRSIAVPGPRPCKRPAPATPPQPSYWTPQPPLLWAVELSWELALDYYGLYDE
RGHPCGYSAVCEENLMPENDQRAT
Download sequence
Identical sequences G5BD18
HGL_N10005559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]