SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_N10007480 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10007480
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000407
Family Canonical RBD 0.00017
Further Details:      
 
Domain Number 2 Region: 115-154
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000000282
Family Ran binding protein zinc finger-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_N10007480
Sequence length 218
Sequence
MIHIYLDKETGKPKGNATVSYEDPLTAKAAVVWFDGKDFQGSKFKVSLVWKKPPMDSMRG
GMPPHEGRGMPPPLCGGPGGPGGPWGPMGSMGGHEGDRGGIPPRGPRGSRGNPSGGGNIP
HGAGDWQCPNPGSGNQNFAWRTECNQCNAPKPEGFLPPPFTPPGGDHGRGGPGGMQGGRG
GLMDHGGPGGMFRGGRGGDRGGFHGGHGINLGGFGGGR
Download sequence
Identical sequences G5ALR7
HGL_N10007480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]