SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_N10007928 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_N10007928
Domain Number - Region: 18-81
Classification Level Classification E-value
Superfamily Tropomyosin 0.00288
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_N10007928
Sequence length 114
Sequence
MEEEDCGKKGKRAVTWVNTRKPMVQGEEEQRSSKRRSKRKRAVESTAQAEAQHAEAERKQ
KVIDQVVSMLEESLNRHRKRMVLVLYHRVMRKRDSCDLEPKAKPELQPKPEPPV
Download sequence
Identical sequences HGL_N10007928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]