SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_N10008871 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10008871
Domain Number 1 Region: 52-286
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000173
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 2 Region: 418-517
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000659
Family Voltage-gated potassium channels 0.04
Further Details:      
 
Weak hits

Sequence:  HGL_N10008871
Domain Number - Region: 356-427
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00565
Family Voltage-gated potassium channels 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_N10008871
Sequence length 616
Sequence
MPGIQLGSGVQRLRPEPQEELPAQENLLLAAAYVSDAQYNRNVPFQTSPQAIRLYCFYNH
WTMRVATYIFICVDLSLALFEEPALFPLPFVATALAEVLCLAAFSARLVHFAKVTPQMVF
WKDTKNICIMVTIVVTLIDLIIYGSLEAVHIHSIRWTRALRPVFLINFPESRQIRRAFRS
IRNTLPDILYVFLLFLFSVLMFSLMALKLFGDRGLKTADGAPYFTNILEIAFELYVLVTT
ANNPDIMMPAYNVSWWYSLYFITYIIINTYIFMSVFLAVVYNNYRKHLKNEIRKLAYLKR
HKMIQAFNILKVKVGTEFVVKEAAWKQLAKVVTPDISSSHLELLLRISDEGQQGIFVWAY
DVIILINAICIALDEKHPFISYAEWLFLALYIIEILLKLYTYEPRAYLGRKQFWNWIFVW
AYDVIILINAICIALDEKHPFISYAEWLFLALYIIEILLKLYTYEPRAYLGRKQFWNWFD
VLIIIAALVATMANAAIQSGGFALVTHQAAKLYFILFHIVVVILIVKEDVQDWKLTGNIG
TVDSTFSGNDGDNRGKALKGLYFRIASKKYRTVDALLQRMFESEIAPNDEGPSLEEILNF
SPSDIYPKNPNFDNSA
Download sequence
Identical sequences G5APS6
HGL_N10008871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]