SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_N10009032 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10009032
Domain Number 1 Region: 28-87
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000475
Family Canonical RBD 0.0072
Further Details:      
 
Weak hits

Sequence:  HGL_N10009032
Domain Number - Region: 5-33
Classification Level Classification E-value
Superfamily Ribosomal proteins S24e, L23 and L15e 0.0149
Family L23p 0.025
Further Details:      
 
Domain Number - Region: 87-116
Classification Level Classification E-value
Superfamily PABC (PABP) domain 0.0654
Family PABC (PABP) domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_N10009032
Sequence length 141
Sequence
MESGRAYKHQAKQDVKKIHDLAAAKVNTLGKFGPALGVKVMTDESGISKGFGFGNFERHA
DAQKDVDEINGKELNGKQIYVGQVPKKESLCSKALEAVDVLQAHRAKEAAQKAVDSAVVF
QLFKIDRGPRKETPASLKKAV
Download sequence
Identical sequences G5C7N0
HGL_N10009032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]