SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_N10014876 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10014876
Domain Number 1 Region: 61-116
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000264
Family Canonical RBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_N10014876
Sequence length 185
Sequence
MLEEVQRALKITTFEAYKISITVAKKQLRNKCKEKRKNENSESPKKELKTKKAKMADKKA
RLVPELQDGKVCGFAFVQFKTLLEKGKAHKGTNIKDIKGWTVAMDWTLAKDKLNDTQSVS
APGEMCLEPKHQESVKKNGRVEEEDAAAAEVDWDDDGEDEEENNKRPHIKDPFAKTWTPG
VVPQA
Download sequence
Identical sequences G5BA85
HGL_N10014876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]