SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_N10019168 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10019168
Domain Number 1 Region: 83-221
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.8e-26
Family Voltage-gated potassium channels 0.0024
Further Details:      
 
Domain Number 2 Region: 197-321
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000551
Family Potassium channel NAD-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_N10019168
Sequence length 390
Sequence
MQLWCFVFSADGGMWKQGGVTVLRHGVTAEGYCRGETVRGMVMQVEGSKEASSEQQAAER
QQKDSRKAAALFLSLIFHPGYLTLSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWEN
FQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIEL
IGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNL
ELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVI
SIKNYHPKIRIITQMLQYHNKVGLWEHSCLRPLQGSVPVSPTTSTPPPQHAHTCAHPHAH
SHAHSHVPVPCKVLSKDMWWLKISLGHFLG
Download sequence
Identical sequences G5BRJ6
HGL_N10019168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]