SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_N10023179 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10023179
Domain Number 1 Region: 44-141
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000000238
Family Ribonuclease PH domain 1-like 0.0031
Further Details:      
 
Domain Number 2 Region: 133-197
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 0.0000000055
Family Ribonuclease PH domain 2-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_N10023179
Sequence length 234
Sequence
MAKPVLHLCGLPPGAQSLLRNLWATSMVICYPVLLPLPTLPHSRKLQVSSGKLARFADGS
AVVQSGGTAEMVTAVSKIKPSPSQFMPLVVDYRQKAAVEVGYFYDTQVLCNLLAVDDINE
LDVLAINGASVALSLSDIPWNGPVGAVRIGMIDGEGVAIGLITKINPEKGEIEDYCLLTD
ILGIEDYNGDMDFKIAVVVACKDRAEEILIAEKEPENRKDGLRLSQQAAGFHLL
Download sequence
Identical sequences G5C6D6
HGL_N10023179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]