SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_N10023540 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_N10023540
Domain Number 1 Region: 7-71
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000048
Family Tropomyosin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_N10023540
Sequence length 71
Sequence
MAGLNSLEAVKRKIQVLQQQADNAEDCPQGLQHERDGEREGLENREKAEGDVVALNGCIQ
LVEKELYRAQE
Download sequence
Identical sequences G5AXQ7
HGL_N10023540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]