SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_R00000005229 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_R00000005229
Domain Number 1 Region: 42-71,116-135
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000406
Family Voltage-gated potassium channels 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_R00000005229
Sequence length 201
Comment Kcnk13 (Rattus_norvegicus) potassium channel, subfamily K, member 13
Sequence
MPRSVGAGQKVGARNAGLRFLSVGAPAPDRSCTPGHLNEDNARFLLLAALILLYLLGGAA
VFSALELAHERQAKQRWEERLANFSRSHNLSREELRGFLRHYEEATRAGIRMDNVRPRWD
FTGAFYFVGTVVSTIEKLRQNSRWKGGKSVNEAVKGGKMFPTGKNQGTSDLWAEQDVEGG
RSRSVYGLVIIRTVGIEKAMG
Download sequence
Identical sequences G5BK47
HGL_R00000005229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]