SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_R00000013095 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_R00000013095
Domain Number 1 Region: 14-59,135-211
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.92e-24
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_R00000013095
Sequence length 307
Comment Ankrd42 (Rattus_norvegicus) ankyrin repeat domain 42
Sequence
MSLLQFVTALTEMSDMTRLHQAVAAGDYSAVKRILKKGLCDPNHKDADWHDRTPLHWAAI
RGGQVAPRQSPGVTIHVVPICQLWVGAGNTPGARQGWSAPTSPCARIAPYTRCLLSQPRS
IVLYNKGSRAALGPVIGHMEVLHLLLEHGARPCLVTDVGWTPAHFAAESGHLGVLKVLHA
LHAAIDAPDFFGDTPKRIAQIYGQSACVAFLEMAELQCRANRLAGLPQDERDPDWDTGKF
RLQRSLRSTAPSTDKRSRGHCRSRLSDTQRRGPLPSRDPVAHTRGHGAPAVTQRPGSSDV
LPPDSHS
Download sequence
Identical sequences G5BNG1
HGL_R00000013095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]