SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_R00000023552 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_R00000023552
Domain Number 1 Region: 18-105
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.14e-20
Family Smg-4/UPF3 0.0000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_R00000023552
Sequence length 144
Comment Upf3a (Rattus_norvegicus) UPF3 regulator of nonsense transcripts homolog A
Sequence
MYSQSTSKSVTSSSYILTQVVLRCPPPRPKKEQLEEQLSLLPAHDYFKVASVDHSLYPHL
YSRAYINFRNPDDILLFRDRFDGYVFMSSKGLEYPAVAEFAPFQKIVRRKLKKRDTKTGS
IKDDPEYKQFLETYSMEEENQCQP
Download sequence
Identical sequences HGL_R00000023552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]