SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_R00000062379 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_R00000062379
Domain Number 1 Region: 96-146
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.42e-17
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_R00000062379
Sequence length 147
Comment Zfp7 (Rattus_norvegicus) zinc finger protein 7
Sequence
MLKHHTSKHHYWATHGQKGRRKRWHHDSQAAVPESLPTRSPAHACHLAGEMEPKAYPLNV
TLKEEQEEEEIRSRELEDGPTDMQKVRICSEGGWVPALFDEVAIYFSDEEWEVLTEQQKA
LYWEVMRMNYETVLSLEFPFPKPDMIS
Download sequence
Identical sequences G5B1T7
HGL_R00000062379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]