SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_D0073543 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_D0073543
Domain Number 1 Region: 88-219
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.24e-31
Family Canonical RBD 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_D0073543
Sequence length 224
Comment fne (Drosophila_melanogaster) found in neurons, isoform A
Sequence
MQVHLSTWVLQDAELQSCVGSLKAQQHTSPPTKAGERRRPRGSSLGEDEEPWVVLQGALY
PAAAITPIAHSVPQPQPLLQQQQQREGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISS
KVFMDRATNQSKCFGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSK
CFGFVSFDNPASAQTGIQAMNGFQIGMKRLKVQLKRPKELGHPY
Download sequence
Identical sequences G5C617
HGL_D0073543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]