SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000007633 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000007633
Domain Number 1 Region: 5-436
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-122
Family ALDH-like 0.000000000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000007633
Sequence length 468
Comment ALDH3B1 (Homo_sapiens) aldehyde dehydrogenase 3 family, member B1
Sequence
MDAFEDTVRRLREAFSSGRTQPAAFRVAQLEGLGRFLQENKQLLQDALAQDLHKSAFESE
VSEIAISQGEVDLALRNLRAWMKDQKVPKNLVTQLDSAFIRKEPFGLVLIIAPWNYPLNL
ILVPLVGAIAAGNCVVLKPSEISKSIEKILAEVLPRYLDQSCFAVALGGPEETARLLEHR
FDYIFFTGNPRVGKIVMAAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRLAWFRYFNT
GQTCVAPDYVLCSSDMQERLLPALQNAITRFYGDDPQNSPNLGRIINQKHFKRLQELLSC
GRVAIGGQSDESNLYIAPTVLVDVQEMDKVMQEEVFGPILPLMTVRSLDEAIDFINRREK
PLALYAFSNNSQVVKQVLARTSSGGFCGNDGFMHMTLASLPFGGVGASGMGSYHGKFSFD
TFSHHRACLLRSPGMEKINDLRYPPYSSRNLRVLLMAMEERSCSCTLL
Download sequence
Identical sequences G5BTV8
HGL_H00000007633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]