SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000218176 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000218176
Domain Number 1 Region: 182-413
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.35e-58
Family Voltage-gated potassium channels 0.0008
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 1.68e-32
Family Tetramerization domain of potassium channels 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000218176
Sequence length 651
Comment KCND1 (Homo_sapiens) potassium voltage-gated channel, Shal-related subfamily, member 1
Sequence
MAAGVATWLPFARAAAVGWLPLAQQPLPPAPGVKASRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQSGDGPTLPAGSSLRQRLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRSPSRRLSREQSCGDRFPTAFFCMDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLFVPKNDDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTSKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSSSGEGQALCVRNRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSEALGAVSLGGCTSRSTSVSSQAVGPGSLLSSCCPRRTKRR
GIRLANSTASVSHGSMQELDTLAGLRRSPAPQSRSSLNAKPYDSLDLNCDSRDFVAAIIS
IPTPPANTPDESQPSSPGGGGSSGGRARSTLRNSSLGTHCLLPETVKISSL
Download sequence
Identical sequences G5BJJ0
XP_004872029.1.39548 HGL_H00000218176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]