SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000231751 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000231751
Domain Number 1 Region: 367-710
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.01e-137
Family Transferrin 0.0000000000889
Further Details:      
 
Domain Number 2 Region: 58-362
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.52e-110
Family Transferrin 0.000000000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000231751
Sequence length 760
Comment LTF (Homo_sapiens) lactotransferrin
Sequence
MGQQGGASPRGLLDKRAQGSSGRALTGCVTTTGSTMRLLLAALLSLSLGDLGLGRATPKE
NVRWCTISQDEVTKCFRLQRNMKKVRGPPVSCIKRASYRDCLRAITDSKADAMTLDGGQL
YEAGQAPYNLRPVAAEVYGTEAQPRTHYYAVVVAKRSSSFRLDQLRGLRSCHTGIRRTAG
WRVPIGLLRPFLNWTGPPEPIEAAVARFFLASCVPGADGARFPNLCRLCAGTGTNKCAFS
TQEPYFGYSGAFKCLREGAGDVAFIKASTVFEDLPDKAQRDQYKLLCPDNTWRPVDEYKQ
CHLARVPSHAVVARSVNGKEDLIWEFLHQAQDSSLGFVRVPKKIDTGLYLGFGYLSSIRN
MEETEADVAARRARVVWCAVGPEEKRKCDRWSSVSGGRVTCTSARTPEDCIPRVMKGEAD
AMSLDGGFIYTAGRCGLVPVLAENQKSQANPGSDCVNRPPEGYLAVAAVRTSDSGLTWNS
LRGRKSCHTAVDRTAGWIIPMGLLFNQTGSCRFGEFFSQSCAPGADPASPLCALCVGNDR
GENKCVANSQERYYGYTGAFRCLAERAGDVAFLKDSTVLQNTDGKSPESWARDLKLADFQ
LLCLDGTRKPVTEARSCHLAMAPNHAVVSRREKAKLLEQVLLDQQARFGRNGSRCPGEFC
LFQSETKNLLFNDNTECLARLQGRTNYETYLGREYVTATANVKRCSTSARFGEFQFGNYM
IGWYIANFECLNLIGSASRAKLQTVAQAIEKNIWVIGVLG
Download sequence
Identical sequences G5ANP4
HGL_H00000231751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]