SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000238688-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000238688-2
Domain Number 1 Region: 2-42
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000582
Family Canonical RBD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000238688-2
Sequence length 50
Comment C14orf156 (Homo_sapiens) SRA stem-loop-interacting RNA-binding protein, mitochondrial Precursor
Sequence
MCWIYFSSEEALQYAVQHENYVIDGVKVYVQIQNPKILQGDQTSDEEKDF
Download sequence
Identical sequences G5BLR2
HGL_H00000238688-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]