SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000261733 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000261733
Domain Number 1 Region: 33-516
Classification Level Classification E-value
Superfamily ALDH-like 5.11e-184
Family ALDH-like 0.0000000000000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000261733
Sequence length 521
Comment ALDH2 (Homo_sapiens) aldehyde dehydrogenase 2 family (mitochondrial)
Sequence
MLRAAAVAAADLGPRLGCRLLSVGAAQAIPTPNQQPEVFYNQIFINNEWHDAVSKKTFPT
VNPSTGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRINASERGRLLYRLADLIERDR
TYLAALETLDNGKPYVISYLVDLDMVLKCIRYYAGWADKYHGKTIPIDGDFFSYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVASLIKEAGFPPGVVN
IVPGFGPTAGAAIASHEDVDKVAFTGSTEVGQLIQVAAGSSNLKKVTLELGGKSPNIIMS
DADMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYEEFVERSVARAKARVVGNPFDSQT
EQGPQVDETQFKKILGYIKSGKEDGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEE
IFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDIDKANYVSQALQAGTVWVNCYNVF
GAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Download sequence
Identical sequences G5AKU7
HGL_H00000261733 XP_004843838.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]