SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000262138 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000262138
Domain Number - Region: 42-79,116-133
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0439
Family Voltage-gated potassium channels 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000262138
Sequence length 261
Comment CACNG4 (Homo_sapiens) calcium channel, voltage-dependent, gamma subunit 4
Sequence
GDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILL
LLGGLCIGAGRIYSRKNNIVLSAGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNH
YNYGWSFYFGALSFIVAETVGVLAVNIYIEKNKELRFKTKREFLKASSSSPYARMPSYRY
RRRRSRSSSRSTEASPSRDASPVGLKITGGIPMGELSMYTLSREPLKVTTAASYSPDQEA
GFLQVHDFFQPDLKEGFHVSM
Download sequence
Identical sequences G5BVD9
HGL_H00000262138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]