SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000273814 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000273814
Domain Number 1 Region: 541-817
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.92e-43
Family Diacylglycerol kinase-like 0.01
Further Details:      
 
Domain Number 2 Region: 358-437
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000034
Family Ras-binding domain, RBD 0.01
Further Details:      
 
Domain Number 3 Region: 133-198
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000401
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0016
Further Details:      
 
Domain Number 4 Region: 77-128
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000558
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.019
Further Details:      
 
Weak hits

Sequence:  HGL_H00000273814
Domain Number - Region: 260-313
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.011
Family Ras-binding domain, RBD 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000273814
Sequence length 842
Comment DGKQ (Homo_sapiens) diacylglycerol kinase, theta 110kDa
Sequence
MIRPYPLASFPIHVHLSPGPGFPVGLFLSSPCRGSASETHVHQPGQARAVCNFMSHEKCL
RHVKTACACVAPSLVRVPVAHCFGPRGLYKRKFCAVCRKGLEAPALRCEVCELHIHADCV
PFACSDCRQCHQDGHHDHDTYHHHWREGNLPLGARCEVCRKTCGSSDVLAGVRCGWCGIQ
AHSLCSSVLAPECTFGQLRSMVLPPGCVRLLSRNFSKMHCFRIAETAALELGDRDDGVDG
SAASGPGRDAPATPESSKQTLEIFDGNDTVRRNRFRLVTVPRLASSEEVLEAALRVYYVS
EDPGDFELQELPLPSLAAVAQTPGKAGSGGLAEEDSTRGSGSHEPEAWVIRARPRAQEVL
KIYPGWLKVGVAYVSIRVTSQSTVRTVVLEVLPLLGRQAEDPENFQLMEVLMGSRQVQRM
VLADEELLLERLWDIRQTSLRQASRTRFYVVESRAVAPRVSLFVGGLPPGLSPRAYGDLL
HEAMATKAAVVSVSHVYSQGAVVLDVTCFAEAERLYMLGRDTAVHGQPLTTLVLPDVLVP
CFRVLVCGGDGTVGWVLTALEETRHRLTCQEPSVAILPLGTGNDLGRVLRWGAGYSGEDP
LSMLVSVDEADAVLVDRWTILLDAHKATGTGNNAVDTEPPKIVQMSNYCGIGIDAELSLD
FHQAREEEPGKFTSRFHNKGVYVRVGLQKISHSRGLHKEIRLQVEQREVELPSIEGLIFI
NIPSWGSGADLWGSDSDSRFEKPRMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYF
RVTLLKATPVQVDGEPWVQAPGHMIISVAGPKVHMLRKAKQKPRKAAATRGHTAPAPEGS
TN
Download sequence
Identical sequences G5BCK1
HGL_H00000273814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]