SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000278723 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000278723
Domain Number 1 Region: 311-424,544-681
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.16e-68
Family Phosphate binding protein-like 0.000000149
Further Details:      
 
Domain Number 2 Region: 3-289
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.83e-32
Family L-arabinose binding protein-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000278723
Sequence length 817
Comment GRIK4 (Homo_sapiens) glutamate receptor, ionotropic, kainate 4
Sequence
LAAHFCSFCQVPHFKVAPEEFVRFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLI
CAKAECLLNLEKLLRQFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSH
TILLKAAELGMVSAYYTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSL
NQSWQENCDHVPFTGPALSSALLFDAVYAVVMAVQELNRSQEIGVKPLSCGSAQIWQHGT
SLMNYLRMVELEGLTGHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSRLY
ASNISDSLFNTTLVVTTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKI
RLVGDGVYGVPEANGTWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISIL
YRVHMGRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCN
LLVNQYSLGNSLWFPVGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLT
VQRMDVPIESVDDLADQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKS
TEEGIARVLNSNYAFLLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDL
AILQLQENNRLEILKRKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAML
EFLWTLRHSEATEVSVCQEMVTELRSIILCQDSIHPRRRRAGIPQPRPPIPEEXRGCTHI
RVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE
Download sequence
Identical sequences G5APF2
HGL_H00000278723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]