SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000288139 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000288139
Domain Number 1 Region: 1065-1326
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-35
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 381-615
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.99e-31
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 3-135,182-253
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-31
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 744-899,939-1017
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.26e-30
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  HGL_H00000288139
Domain Number - Region: 1331-1478
Classification Level Classification E-value
Superfamily EF-hand 0.00979
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000288139
Sequence length 2018
Comment CACNA1D (Homo_sapiens) calcium channel, voltage-dependent, L type, alpha 1D subunit
Sequence
EKVEYAFLIIFTVETFLKIIAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKET
EGGNHSSGKSGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFV
IIIYAIIGLELFIGKMHKTCFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPN
GGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLV
LGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGK
RNTSMPTSETESVNTENVSGEGETKGCCRRLWCWWRRRGTAKTGPSGCRRWGQAISKSKL
SRRWRRWNRFNRRRCRAAVKSVTFYWLVIVLVFLNTLTISSEHYNQPGWLTQIQDIANKV
LLALFTCEMLIKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCV
RLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDET
QTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNY
ILLNVFLAIAVDNLADAESLNTAQKEEAEEKERKKIARKESLENKKNHKPEVNQIANSDN
KVTVDDYREEDEDKDPYPPCDVPVGEEEEEEEEDEPEVPAGPRPRRISELNMKEKIAPIP
EGSAFFILSKTNPIRVGCHKLINHHVFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGY
FDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVK
ILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKF
YRCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFE
GWPALLYKAIDSNGENVGPVYNYRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEK
EYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLC
LAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSI
IDVALSEADPTESDNVPVPTATPGNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLW
TFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAVLLLFR
CATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSSFAIVYFISFYMLCAFLIINLFVA
VIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKL
CPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKIW
KKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQ
AGLRTLHDIGPEIRRAISCDLQDDEPEEKREEEDVFKRNGALLGNHVNHVNSDRRDSLQQ
TNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHSRPNRNSVGKQVPTSTNANLNNANM
SKAAHGKRPSTGDLEHVSENGHHSSHKHDREPPRWSSIKRTRYYEMYIRSDSGDEQFPTI
CREDPEIHGYFRDPRCLGEQEYFSSEECYEEDSSPTWSRQNYSCYNRYLGGTTDFERPRG
YHPPQGCSEDDDSPVCYDSRRSPRRRLLPPTPPPHRRSSFNFECLRRQSSQEEAPPSPTL
PHRTALPLHLMQQQIMAVAGLDSSRAPKYSPSHSTRSWATPPATPPYRDWTPCYTPLIQV
ERSESLDQVNGSLPSLHRSSWYTDEPDISYRTFTPASLTVPSRFRNKNSDKQRSADSLVE
AVLISEGLGRYARDPKFVSATKHEIADACDLTIDEMESAASTLLNGSMGPRASGDVGLVS
HRQDYELQEFGPGYSDEEPDPGRDEEDLADEMICITTL
Download sequence
Identical sequences G5BUP2
HGL_H00000288139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]