SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000296350 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000296350
Domain Number 1 Region: 368-706
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.67e-110
Family Transferrin 0.000000775
Further Details:      
 
Domain Number 2 Region: 25-358
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.79e-108
Family Transferrin 0.000000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000296350
Sequence length 713
Comment MFI2 (Homo_sapiens) antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5
Sequence
MRGRRAALWLLLCLRAVLNGEQVTEMRWCTISDAEQLKCKDMSKAFQEVGIQPFIACVQG
TSALHCTQLISAQKADAVTLNGEAIYEAGKEHGLKPVLGELYDAEVGTSYYAVAVVRKNS
SVTVNTLKGVRSCHTGLHRTAGWNVPVGFLVGSGRLSVMGCDMLMAVSEFFGGSCVPGAG
ETNHSLSLCRACRGDGSGKRVCDSSPLERYYGYSGAFRCLAEGAGDVAFVRHSTVLENTD
GKTLPSWDKALLSRDFELLCRNGSRASVTEWRQCHLARVPASAVVVRPDMDEKLLFRLLG
EGQLLFNHEGSPFQMFRSESYGHRDLLFKDATVELVPIGTKTYEAWLGRNFLHAMKGLLC
DPNQLPHFLRWCVLSTPEFRKCGDMAMAFNQQKLKPEIQCVWANSPLQCMTQIQDGHIDA
VTLRGEDIYTAGKMFGLVPAAGESYTENSSSSYYAVALVRRDISSAFSLNELRGKRSCHP
SVDSPAGWTVPMGTLVYTGSIRPRDCNVIQGMSEVFNGSCVPGSEARKYPSSLCAICEGD
EKGRNKCVANSQERYFGDSGAFRCLTEKAGDIAFVKHTTVFDNTNGHTTEPWAAGLRHQD
YQLLCPNGARAEVHQFQACSLAKVPAHAVMVRPDTNTFPVFGLLDKAQELYGEDNNKNGF
QMFDSYKYGGQDLLFQDVTVRLVPVAEKSTYLGWLGPDYVRAMEGLLTPPCSG
Download sequence
Identical sequences G5ALD3
HGL_H00000296350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]