SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000300574 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000300574
Domain Number 1 Region: 135-153,209-301
Classification Level Classification E-value
Superfamily SH3-domain 1.22e-24
Family SH3-domain 0.0000291
Further Details:      
 
Domain Number 2 Region: 105-194,235-261
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-17
Family SH2 domain 0.0000107
Further Details:      
 
Domain Number 3 Region: 283-374
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000223
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000300574
Sequence length 378
Comment CRK (Homo_sapiens) v-crk sarcoma virus CT10 oncogene homolog (avian)
Sequence
MAVAGPLPGSLPGAGSASLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQRHGVFLVRDSSTSPGD
YVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVNPSRLRIGDQEFDSLPALLEFYKI
HYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPE
EQWWNAEDSEGKRGMIPVPYVEKYRPSSASVSALIGGNQEGSHPQPLGGPEPGPYAQPSV
NTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHF
PFTHVRLLDQQNPDEDFS
Download sequence
Identical sequences HGL_H00000300574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]