SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000307694 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000307694
Domain Number 1 Region: 296-546
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.22e-49
Family Voltage-gated potassium channels 0.0014
Further Details:      
 
Domain Number 2 Region: 181-242
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000262
Family Tetramerization domain of potassium channels 0.0014
Further Details:      
 
Weak hits

Sequence:  HGL_H00000307694
Domain Number - Region: 35-63
Classification Level Classification E-value
Superfamily Elafin-like 0.00017
Family Elafin-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000307694
Sequence length 611
Comment KCNS1 (Homo_sapiens) potassium voltage-gated channel, delayed-rectifier, subfamily S, member 1
Sequence
MRIQSILLLVALLALGSQVPAASGRRKGDDKPCLSVPDQCTGDSQCPSGKKCCSQACFRQ
CVPRVLVKRGSCPEDRLRARRSTCVTMTMTAHEGSGVAQVPVAGTAETLPEALEHRAPGK
SPGKSPGKSPGRAGRCSHGERVFGAQRPGPLAAEGRGAARERRRRAAAAERARAGALPNA
AAREFYFDRHPGFFLGLLHFYRTGRLHLLDELCVFAFGQEADYWGLGENALATCCRARYL
ERRMARPRAWDEDSDPPSSGDPCPDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSL
PSKLFSCVSIGVVLASIAAMCIHSLPEYQAREAAAAVAAVGAGRNADDARDDPVLRRLEY
FCIAWFSFEVSSRLLLAPSTRNFFCHPLNLIDIVSVLPFYLTLLAGIALGDRDGGSGEEL
GDLGKVVQVFRLMRIFRVLKLARHSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSGVA
YTAEEKNVGFNTIPACWWWGTVSMTTVGYGDVVPETVAGKLAASGCILGGILVVALPITI
IFNKFSHFYRCQKALEAAVRNSGHREFEDLLSSVDGVSEASLETSRDTSQEGRSVDLETQ
AQGEPPNTQSY
Download sequence
Identical sequences G5BB26
HGL_H00000307694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]